Search

Home / MyBioSource / Life Science Supplies
Recombinant Arabidopsis thaliana Aquaporin PIP2-2 (PIP2-2) (Recombinant Protein) in Saudi Arabia

Recombinant Arabidopsis thaliana Aquaporin PIP2-2 (PIP2-2) (Recombinant Protein)

SAR 0

1 +

Special Features

  • GeneName: PIP2B; PIP2;2; plasma membrane intrinsic protein 2; PLASMA MEMBRANE INTRINSIC PROTEIN 2;2
  • SynName: Recombinant Aquaporin PIP2-2 (PIP2-2); Aquaporin PIP2-2
  • T2N18.7; T2N18_7; PIP2-2; AtPIP2;2; PIP2b
  • Plasma membrane intrinsic protein 2-2; AtPIP2;2 Plasma membrane intrinsic protein 2b; PIP2b TMP2b
  • aquaporin PIP2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b
  • Source: E Coli or Yeast
  • Purity: >90%; *Tag Information: His tagged; *Species: Arabidopsis thaliana (Mouse-ear cress)
  • Storage Buffer: PBS pH 7.4, 50% glycerol; *SeqPos: 2-285
  • Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
  • FREE-8GB-USBDrive for this item. Item is for research use. NOT for diagnostic/therapeutic procedure.

Description

*Form: This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.; *Seq: AKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV; *Accession#: NP_181254.1; NM_129273.4; P43287; *NCBI Summary: a member of the plasma membrane intrinsic protein subfamily PIP2. localizes to the plasma membrane and exhibits water transport activity in Xenopus oocyte. expressed specifically in the vascular bundles and protein level increases slightly during leaf dev; *Uniprot Summary: Function: Water channel required to facilitate the transport of water across cell membrane. Plays an predominant role in root water uptake process in conditions of reduced transpiration, and in osmotic fluid transport. Its function is impaired by Hg2+. Inhibited by cytosolic acidosis which occurs during anoxia in roots. Ref.1 Ref.5 Ref.7Subcellular location: Cell membrane; Multi-pass membrane protein Ref.5. Tissue specificity: Predominantly expressed in the root, with a strong expression in the cortex, endodermis, and stele. Ref.5 Ref.6Domain: Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. PIP (TC 1.A.8.11) subfamily. [View classification]

Related Items


{"error":"Error","cart_limit":"You have too many items in your cart.","prod_limit":"You cannot add any more of this item"}