Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
FREE-8GB-USBDrive for this item. Item is for research use. NOT for diagnostic/therapeutic procedure.
Description
*Form: This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.; *Seq: ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF; *Accession#: NP_415335.1; NC_000913.2; P0A917; *NCBI Summary: ompX is nduced by acid or base. [More information is available at EcoGene: EG12135]. OmpX is a small (18 kDa) outer-membrane protein (OMP). [More information is available at EcoCyc: EG12117].; *Uniprot Summary: Subcellular location: Cell outer membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the Ail/OmpX/PagC/Lom family.